You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594838 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-10(Il10) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.9 kDa |
UniProt ID | P18893 |
Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | 19-178aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. |
Expression Region | 19-178aa |
Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4mM HCl. |
Alternative names | Interleukin-10;Il10;IL-10;Cytokine synthesis inhib Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
18.7 kDa | |
E.Coli |
Unconjugated | |
95% | |
14.8 kDa | |
Mouse TIGIT, His Tag (orb348797) is expressed from human 293 cells (HEK293). It contains AA Gly 26 - Thr 143 (Accession # NP_001139797.1). |
Unconjugated | |
95% | |
39.5 kDa | |
Mouse TIGIT, Fc Tag (orb334938) is expressed from human 293 cells (HEK293). It contains AA Gly 26 - Thr 143 (Accession # NP_001139797.1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 98.0% as determined by RP-HPLC and analysis by SDS-PAGE |
Filter by Rating