You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Il10 protein
Catalog Number: orb594838
| Catalog Number | orb594838 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-10(Il10) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 18.9 kDa |
| UniProt ID | P18893 |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. |
| Expression Region | 19-178aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | Interleukin-10;Il10;IL-10;Cytokine synthesis inhib Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse IL10 protein (Active) [orb359015]
> 97% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
500 μg, 100 μg, 10 μg 
Mouse IL10 protein [orb391909]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg- Item 1 of 1
Mouse IL10 protein [orb80068]
FA, HPLC, SDS-PAGE
Unconjugated
> 98.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 100 μg, 500 μg Recombinant Mouse Interleukin-10 protein(Il10) (Active) [orb1650677]
10 μg, 100 μg, 1 mg, 250 μg, 500 μg
