Mouse Il10 protein

• Catalog Number: orb594838
• Category: Proteins
• Description: Recombinant Mouse Interleukin-10(Il10) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 18.9 kDa
• UniProt ID: P18893
• Protein Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.
• Expression Region: 19-178aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Alternative names: Interleukin-10;Il10;IL-10;Cytokine synthesis inhib
• Background: Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.
• Note: For research use only
• Application notes: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.