Mouse Il10 protein

Catalog Number: orb594838

Catalog Number	orb594838
Category	Proteins
Description	Recombinant Mouse Interleukin-10(Il10) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	18.9 kDa
UniProt ID	P18893
Protein Sequence	SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	19-178aa
Biological Activity	The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml.
Expression Region	19-178aa
Endotoxins	Less than 0.01 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 4mM HCl.
Alternative names	Interleukin-10;Il10;IL-10;Cytokine synthesis inhib Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	18.7 kDa
Source:	E.Coli

Conjugation:	Unconjugated
Purity:	95%
MW:	14.8 kDa
Source:	Mouse TIGIT, His Tag (orb348797) is expressed from human 293 cells (HEK293). It contains AA Gly 26 - Thr 143 (Accession # NP_001139797.1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli

Applications:	FA, HPLC, SDS-PAGE
Conjugation:	Unconjugated
Purity:	> 98.0% as determined by RP-HPLC and analysis by SDS-PAGE