Mouse Csf2 protein

Catalog Number: orb594720

Catalog Number	orb594720
Category	Proteins
Description	Recombinant Mouse Granulocyte-macrophage colony-stimulating factor(Csf2) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	14.2 kDa
UniProt ID	P01587
Protein Sequence	APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	18-141aa
Biological Activity	The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 15-50 pg/ml.
Expression Region	18-141aa
Endotoxins	Less than 0.01 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 1mM EDTA, pH 8.0.
Alternative names	Granulocyte-macrophage colony-stimulating factor;C Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Purity:	> 98% as determined by SDS-PAGE and HPLC.
MW:	14.1 kDa
Source:	E.Coli

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	15.1 kDa
Source:	Mammalian cell

Conjugation:	Unconjugated
Purity:	95%
MW:	24.4 kDa
Source:	Mouse PD-L2, His Tag (orb348790) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Arg 219 (Accession # NP_067371).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells