You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 15-50 pg/ml. |
| Tag | Tag-Free |
| Expression Region | 18-141aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 14.2 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Granulocyte-macrophage colony-stimulating factor;Csf2;GM-CSF;Colony-stimulating factor;Csfgm
Similar Products
−Mouse Csf2 protein [orb594719]
Greater than 95% as determined by SDS-PAGE.
15.1 kDa
Mammalian cell
50 μg, 10 μg, 1 mg, 500 μgMouse CSF2 protein (Active) [orb359038]
> 98% as determined by SDS-PAGE and HPLC.
14.1 kDa
E.Coli
500 μg, 100 μg, 5 μgRecombinant Mouse CSF2/GM-CSF Protein, N-His [orb2962498]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
16.41 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse CSF2/GM-CSF Protein, C-His [orb2966266]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
17.02 kDa
1 mg, 50 μg, 100 μgCsf2 (NM_009969) Mouse Recombinant Protein [orb3035927]
>95% as determined by SDS-PAGE and Coomassie blue staining
14.2 kDa
50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



