You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594719 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Granulocyte-macrophage colony-stimulating factor(Csf2) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 15.1 kDa |
UniProt ID | P01587 |
Protein Sequence | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 18-141aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml. |
Expression Region | 18-141aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4. |
Alternative names | Granulocyte-Macrophage Colony-Stimulating Factor; Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 98% as determined by SDS-PAGE and HPLC. | |
14.1 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
14.2 kDa | |
E.coli |
Unconjugated | |
95% | |
24.4 kDa | |
Mouse PD-L2, His Tag (orb348790) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Arg 219 (Accession # NP_067371). |
Unconjugated | |
95% | |
49.2 kDa | |
Mouse PD-L2, Fc Tag (orb383511) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Arg 219 (Accession # NP_067371). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Filter by Rating