You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Csf2 protein
Catalog Number: orb594719
| Catalog Number | orb594719 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Granulocyte-macrophage colony-stimulating factor(Csf2) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01587 |
| MW | 15.1 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml. |
| Expression Region | 18-141aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Granulocyte-Macrophage Colony-Stimulating Factor; Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse CSF2 protein (Active) [orb359038]
> 98% as determined by SDS-PAGE and HPLC.
14.1 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Mouse Csf2 protein [orb594720]
Greater than 95% as determined by SDS-PAGE.
14.2 kDa
E.coli
10 μg, 50 μg, 1 mg, 500 μg 
Mouse CSF2 protein [orb391539]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgMouse CSF2 protein [orb391540]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgRecombinant Mouse GM-CSF/CSF2 Protein, His Tag [orb1551148]
> 97% by SDS-PAGE.
Recombinant Mouse GM-CSF/CSF2 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala18-Lys141) of mouse GM-CSF/CSF2 (Accession #NP_034099.2) fused with a 6��His Tag at the N-terminus.
100 μg, 50 μg
