Cart summary

You have no items in your shopping cart.

Mouse CSF2 protein (Active)

Catalog Number: orb359038

DispatchUsually dispatched within 1-2 weeks
$ 210.00
Catalog Numberorb359038
CategoryProteins
DescriptionRecombinant mouse CSF2 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, pH 7.4
Purity> 98% as determined by SDS-PAGE and HPLC.
Protein SequenceAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFE QGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKK PGQK
Protein LengthFull Length of Mature Protein
UniProt IDP01587
MW14.1 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginMus musculus (Mouse)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine FDC-P1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
Expression Region18-141aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesGM-CSF, CSF
NoteFor research use only
Mouse CSF2 protein (Active)