MGP Antibody

SKU: orb334985

Description

Goat polyclonal antibody to MGP. This protein is secreted and likely to act as an inhibitor of bone formation. It is found in the organic matrix of bone and cartilage and defects in the gene are a cause of Keutel syndrome.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:250-1:2,000
• Reactivity: Zebrafish
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 26 aa to the C-terminus of zebra fish MGP produced in E. coli. Antigen Sequence: ESRESLEVFVNPYQANAFMRNTQHNPYIYRRMKTPAERRAEVCEDFSPCRVFALRYGSQVAYQTFFSPQQLRANQQLRRY
• Target: Matrix Gla protein
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GIG36, matrix Gla protein, MGLAP, NTI antibody.

Quick Database Links

Gene Symbol

Matrix Gla protein