Cart summary

You have no items in your shopping cart.

MAX Rabbit Polyclonal Antibody

SKU: orb329964

Description

Rabbit polyclonal antibody to MAX

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MAX
TargetMAX
Protein SequenceSynthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
Molecular Weight18kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti orf1 antibody, anti bHLHd4 antibody, anti bHLHd5 antibody, anti bHLHd6 antibody, anti bHLHd7 antibody, anti bHLHd8 antibody

Similar Products

  • P38 MAPK Rabbit Polyclonal Antibody [orb11207]

    FC,  ICC

    Canine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-p38 MAPK (Thr180 + Tyr182) Rabbit Polyclonal Antibody [orb6578]

    ELISA,  FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-P38 MAPK (Thr180 + Tyr182) Rabbit Polyclonal Antibody [orb11208]

    IF,  IHC-Fr,  IHC-P

    Canine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-P38 MAPK (Thr180) Rabbit Polyclonal Antibody [orb7089]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-p38 MAPK (Tyr323) Rabbit Polyclonal Antibody [orb7090]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MAX Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

MAX Rabbit Polyclonal Antibody

Rabbit Anti-MAX Antibody, Catalog Number: orb329964, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

MAX Rabbit Polyclonal Antibody

WB Suggested Anti-MAX Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002373

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MAX Rabbit Polyclonal Antibody (orb329964)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry