You have no items in your shopping cart.
Description
Research Area
Epigenetics, GPCR, Neuroscience, Signaling Pathways
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human LTB4R2 |
| Target | LTB4R2 |
| Protein Sequence | Synthetic peptide located within the following region: TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP |
| Molecular Weight | 42kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti-LTB4 R 2 antibody, anti-LTB4 R2 antibody, anti-LTB4R2 antibody, anti-LTB4R 2 antibody, anti-LTB4-R2 antibody, anti-BLT2R antibody, anti-JULF2 antibody, anti-Leukotriene B4 receptor 2 antibody, anti-Leukotriene B4 receptor BLT2 antibody, anti-LTB4 receptor 2 antibody
Similar Products
−LTB4R2 Rabbit Polyclonal Antibody [orb331272]
WB
Bovine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlLTB4-R2 Rabbit Polyclonal Antibody [orb6336]
WB
Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Placenta lysates, Antibody dilution: 1.0 ug/ml.
Quick Database Links
Gene Symbol
LTB4R2
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
LTB4R2 Rabbit Polyclonal Antibody (orb331273)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




