You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
LTB4R2 Rabbit Polyclonal Antibody
Catalog Number: orb331272
| Catalog Number | orb331272 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LTB4-R2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 38kDa |
| Target | LTB4R2 |
| UniProt ID | Q5KU28 |
| Protein Sequence | Synthetic peptide located within the following region: VNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQ |
| NCBI | NP_001158164 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti-LTB4 R 2 antibody, anti-LTB4 R2 antibody, ant Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-LTB4R2 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, LTB4R2 is supported by BioGPS gene expression data to be expressed in 721_B.
- Item 1 of 1
- Item 1 of 1
LTB4-R2 Rabbit Polyclonal Antibody [orb6336]
WB
Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
