KCNAB2 Rabbit Polyclonal Antibody

• Catalog Number: orb588287
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNAB2
• Target: KCNAB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
• Protein Sequence: Synthetic peptide located within the following region: TWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKE
• UniProt ID: Q13303
• MW: 45 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, H
• Research Area: Cardiovascular Research, Cell Biology, Molecular B
• Note: For research use only
• NCBI: NP_001186789.1
• Expiration Date: 12 months from date of receipt.

Sample Tissue: MCF7 Whole Cell lysates, Antibody Dilution: 1 ug/ml.