You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324607 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNAB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | KCNAB2 |
UniProt ID | Q13303 |
Protein Sequence | Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL |
NCBI | NP_742128 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AKR6A5 antibody, anti KCNA2B antibody, anti H Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.
WB Suggested Anti-KCNAB2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |