KCNAB2 Rabbit Polyclonal Antibody

• Catalog Number: orb324607
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNAB2
• Target: KCNAB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB2
• Protein Sequence: Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL
• UniProt ID: Q13303
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AKR6A5 antibody, anti KCNA2B antibody, anti H
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_742128
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.

WB Suggested Anti-KCNAB2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.