KCNAB2 Rabbit Polyclonal Antibody

• Catalog Number: orb324736
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNAB2
• Target: KCNAB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
• Protein Sequence: Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
• UniProt ID: Q13303
• MW: 40kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AKR6A5 antibody, anti KCNA2B antibody, anti H
• Research Area: Cardiovascular Research
• Note: For research use only
• NCBI: NP_003627
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-KCBAB2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Sample Type: P48 Mouse, Dilution: 1:2000 tested with brain slices in Immunohistochemistry.

WB Suggested Anti-KCNAB2 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.

WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.