KCNAB2 Rabbit Polyclonal Antibody

SKU: orb324736

Description

Rabbit polyclonal antibody to KCNAB2

Research Area

Metabolism Research

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
• Target: KCNAB2
• Protein Sequence: Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AKR6A5 antibody, anti KCNA2B antibody, anti HKvbeta2 antibody, anti KV-BETA-2 antibody, anti HKvbeta2.1 antibody, anti HKvbeta2.2 antibody

Rabbit Anti-KCBAB2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Sample Type: P48 Mouse, Dilution: 1:2000 tested with brain slices in Immunohistochemistry.

WB Suggested Anti-KCNAB2 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.

WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.

Quick Database Links

Gene Symbol

KCNAB2

UniProt

Q13303

RefSeq (Protein):NP_003627