KCNAB2 Rabbit Polyclonal Antibody

• Catalog Number: orb324737
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNAB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: KCNAB2
• UniProt ID: Q13303
• Protein Sequence: Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
• NCBI: NP_003627
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AKR6A5 antibody, anti KCNA2B antibody, anti H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Feng Cheng, Yu-fei Tang, Yang Cao, Shi-qing Peng, Xiao-ren Zhu, Yue Sun, Shu-Hang Wang, Bin Wang & Yi-min Lu KCNAB2 overexpression inhibits human non-small-cell lung cancer cell growth in vitro and in vivo Nature, 9, 382 (2023)

PubMed:

Human kidney

Sample Type: P48 Mouse Dilution: 1:2000 tested with brain slices in Immunohistochemistry.

WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

WB Suggested Anti-KCNAB2 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.