You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324606 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNAB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | KCNAB2 |
UniProt ID | Q6FG44 |
Protein Sequence | Synthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS |
NCBI | NP_742128 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AKR6A5 antibody, anti HKvbeta2 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human heart tissue using KCNAB2 antibody
Western blot analysis of human HepG2 tissue using KCNAB2 antibody
Western blot analysis of Jurkat cell lysate tissue using KCNAB2 antibody
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating