IRAK4 Rabbit Polyclonal Antibody

• Catalog Number: orb585023
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRAK4
• Target: IRAK4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS
• UniProt ID: Q9NWZ3
• MW: 36kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IPD1, IMD67, REN64, IRAK-4, NY-REN-64
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_001138728

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. IRAK4 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-IRAK4 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.