You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330971 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to IGF2BP1 |
| Target | IGF2BP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1 |
| Protein Sequence | Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP |
| UniProt ID | Q9NZI8 |
| MW | 63 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CRD-BP antibody, anti CRDBP antibody, anti IM Read more... |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_006537 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be phosphorylated.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Application: IHC, Species+tissue/cell type: Human small intestine, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP.

Sample Type: Human lung carcinoma, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review