Cart summary

You have no items in your shopping cart.

IGF2BP1 Rabbit Polyclonal Antibody

SKU: orb330971

Description

Rabbit polyclonal antibody to IGF2BP1

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
TargetIGF2BP1
Protein SequenceSynthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
Molecular Weight63 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CRD-BP antibody, anti CRDBP antibody, anti IMP-1 antibody, anti IMP1 antibody, anti VICKZ1 antibody, anti ZBP1 antibody

Similar Products

  • IGF2BP1 Rabbit Polyclonal Antibody [orb1518]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • IGF2BP1 Rabbit Polyclonal Antibody [orb330140]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Igf2bp1 Rabbit Polyclonal Antibody [orb330970]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • IMPI/IGF2BP1 Rabbit Polyclonal Antibody [orb865415]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • IGF2BP1 Antibody [orb627945]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IGF2BP1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be phosphorylated.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human small intestine, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Type: Human lung carcinoma, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.

IGF2BP1 Rabbit Polyclonal Antibody

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006537

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

IGF2BP1 Rabbit Polyclonal Antibody (orb330971)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry