You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330140 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IGF2BP1 |
Target | IGF2BP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1 |
Protein Sequence | Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT |
UniProt ID | Q9NZI8 |
MW | 63kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CRD-BP antibody, anti CRDBP antibody, anti IM Read more... |
Note | For research use only |
NCBI | NP_006537 |
Sample Type: Human lung adenocarcinoma, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody Dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.
Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP, Secondary antibody Dilution: NOT FOUND.
WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Other, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |