IGF2BP1 Rabbit Polyclonal Antibody

• Catalog Number: orb330140
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGF2BP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: IGF2BP1
• UniProt ID: Q9NZI8
• Protein Sequence: Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT
• NCBI: NP_006537
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CRD-BP antibody, anti CRDBP antibody, anti IM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human lung adenocarcinoma, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody Dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP, Secondary antibody Dilution: NOT FOUND.

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.