Igf2bp1 Rabbit Polyclonal Antibody

• Catalog Number: orb330970
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Igf2bp1
• Target: Igf2bp1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
• UniProt ID: O88477
• MW: 63kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AL024068 antibody, anti AW549074 antibody, an
• Note: For research use only
• NCBI: NP_034081

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

WB Suggested Anti-Igf2bp1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.