You have no items in your shopping cart.
Cart summary
Human TNFRSF4 protein
Catalog Number: orb594878
| Catalog Number | orb594878 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 21 kDa |
| UniProt ID | P43489 |
| Protein Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 29-216aa. Protein Length: Partial |
| Biological Activity | The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 25 ug/ml. |
| Expression Region | 29-216aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human OX40 / TNFRSF4 / CD134 Protein [orb257728]
Unconjugated
90%
22.0 kDa
Human OX40 Protein, His Tag (orb257728) is expressed from human 293 cells (HEK293). It contains AA Leu 29 - Ala 216 (Accession # P43489-1).
1 mg, 100 μg - Item 1 of 2
Human OX40 / TNFRSF4 / CD134 Protein [orb257729]
Unconjugated
90%
46.8 kDa
Human OX40, Fc Tag (orb257729) is expressed from human 293 cells (HEK293). It contains AA Leu 29 - Ala 216 (Accession # NP_003318).
1 mg, 100 μg Human TNFRSF4 protein [orb594879]
Greater than 95% as determined by SDS-PAGE.
46.8 kDa
Mammalian cell
500 μg, 1 mg, 10 μg, 50 μgHuman TNFRSF4 protein [orb706829]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman OX40 Protein, hFc-His tag [orb689383]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.2 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars