You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 2
Item 1 of 2
Human Novel Coronavirus Spike glycoprotein(S) protein
Catalog Number: orb668859
| Catalog Number | orb668859 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Novel Coronavirus Spike glycoprotein(S) (D614G) protein |
| Tag | C-terminal 10xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR |
| Protein Length | Partial |
| UniProt ID | P0DTC2 |
| MW | 77.8 kDa |
| Application notes | SARS-CoV-2 Related Proteins |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1 (D614G) at 2 μg/ml can bind human ACE2, the EC50 is 8.236-11.22 ng/ml. |
| Expression Region | 16-685aa (D614G) |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | / |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1 (D614G) at 2 μg/ml can bind human ACE2, the EC50 is 8.236-11.22 ng/ml.
- Item 1 of 6
Human Novel Coronavirus Spike glycoprotein protein [orb640277]
Greater than 90% as determined by SDS-PAGE.
38.2 kDa
Yeast
1 mg, 100 μg, 20 μg - Item 1 of 6
Human Novel Coronavirus Spike glycoprotein(S) protein [orb668860]
Greater than 90% as determined by SDS-PAGE.
30.1 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 3
Human Novel Coronavirus Spike glycoprotein(S) protein (Biotin) [orb668865]
Greater than 90% as determined by SDS-PAGE.
54.1 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 3
Human 2019-nCOV-S protein [orb638762]
Greater than 85% as determined by SDS-PAGE.
79.6 kDa
Mammalian cell
20 μg, 1 mg, 100 μg - Item 1 of 3
Human Novel Coronavirus Spike glycoprotein protein [orb640279]
Greater than 90% as determined by SDS-PAGE.
51.1 kDa
Mammalian cell
20 μg, 100 μg, 1 mg
