Human Novel Coronavirus Spike glycoprotein(S) protein

• Catalog Number: orb668861
• Category: Proteins
• Description: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (V367F) protein
• Tag: C-terminal 10xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 27.9 kDa
• UniProt ID: P0DTC2
• Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Protein Length: Partial (S1-RBD)
• Source: Mammalian cell
• Expression System: Expression Region: 319-541aa(V367F). Protein Length: Partial
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V367F) at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 65.58-90.16 ng/ml.
• Expression Region: 319-541aa (V367F)
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Alternative names: /
• Note: For research use only
• Application notes: SARS-CoV-2 Related Proteins
• Expiration Date: 6 months from date of receipt.