You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL4R protein
Catalog Number: orb594781
| Catalog Number | orb594781 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Protein Length | Extracellular Domain |
| UniProt ID | P24394 |
| MW | 24.4 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml. |
| Expression Region | 26-232aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-4 receptor subunit alpha; IL-4 recepto Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial [orb2666668]
Greater than 95% as determined by SDS-PAGE.
25.2 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
- Item 1 of 1
Human IL4R protein [orb594782]
Greater than 95% as determined by SDS-PAGE.
50.2 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial [orb1785339]
Greater than 90% as determined by SDS-PAGE.
25.4 kDa
Mammalian cell
20 μg, 1 mg, 100 μg - Item 1 of 1
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial [orb1785593]
Greater than 90% as determined by SDS-PAGE.
29.9 kDa
E.coli
1 mg, 20 μg, 100 μg
