You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL3 protein
Catalog Number: orb594806
| Catalog Number | orb594806 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-3(IL3) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P08700 |
| MW | 16.1 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 0.3-1.5 ng/ml. |
| Expression Region | 20-152aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-3; IL-3; Hematopoietic Growth Factor; Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL3 protein (Active) [orb358969]
> 96% as determined by SDS-PAGE and HPLC.
15.0 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL3 protein [orb594807]
Greater than 95% as determined by SDS-PAGE.
16.6 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 3
Human IL-3 (N-6His) Protein [orb1471727]
Greater than 95% as determined by reducing SDS-PAGE.
16.6 KDa
Mammalian
10 μg, 50 μg - Item 1 of 2
Human IL3 protein [orb604192]
Greater than 85% as determined by SDS-PAGE.
17.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
