You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 0.3-1.5 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 20-152aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 16.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Similar Products
−- Item 1 of 1
Human IL3 protein [orb594807]
Greater than 95% as determined by SDS-PAGE.
16.6 kDa
E.coli
50 μg, 10 μg, 1 mg, 500 μg - Item 1 of 1
Human IL3 protein (Active) [orb358969]
> 96% as determined by SDS-PAGE and HPLC.
15.0 kDa
E.Coli
500 μg, 100 μg, 10 μg - Item 1 of 3
IL3 Mouse Monoclonal Antibody [orb2959087]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 3
Human IL-3 (N-6His) Protein [orb1471727]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
16.6 KDa
Mammalian
10 μg, 50 μg - Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks