You have no items in your shopping cart.
Human IL3 protein
SKU: orb594807
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89uM as determined in BLI assay. ②Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 16.6 kDa |
| Expression Region | 20-152aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Similar Products
−- Item 1 of 1
Human IL3 protein [orb594806]
Greater than 95% as determined by SDS-PAGE.
16.1 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL3 protein (Active) [orb358969]
> 96% as determined by SDS-PAGE and HPLC.
15.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 3
Human IL-3 (N-6His) Protein [orb1471727]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
16.6 KDa
Mammalian
50 μg, 10 μg - Item 1 of 2
Human IL3 protein [orb604192]
Greater than 95% as determined by SDS-PAGE.
22.0 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL3 protein (orb594807)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks