You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594807 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-3(IL3) (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 16.6 kDa |
UniProt ID | P08700 |
Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | 20-152aa |
Biological Activity | ①Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89uM as determined in BLI assay. ②Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay. |
Expression Region | 20-152aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20mMPB,5%Sucrose,0.05%Tween80,pH 6.5. |
Alternative names | Interleukin-3; IL-3; Hematopoietic Growth Factor; Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 96% as determined by SDS-PAGE and HPLC. | |
15.0 kDa | |
E.Coli |
Unconjugated | |
85% | |
37.7 kDa | |
Human IL-5 R alpha, His Tag (orb257612) is expressed from human 293 cells (HEK293). It contains AA Asp 21 - Glu 335 (Accession # NP_000555). |
Unconjugated | |
90% | |
19.9 kDa | |
Human Flt-3 Ligand, His Tag (orb257477) is expressed from human 293 cells (HEK293). It contains AA Thr 27 - Pro 185 (Accession # P49771-1). |
Greater than 95% as determined by SDS-PAGE. | |
16.1 kDa | |
Mammalian cell |
Unconjugated | |
90% | |
17.0 kDa | |
Human IL-3 Protein, His Tag, premium grade (orb1087548) is expressed from human 293 cells (HEK293). It contains AA Ala 20 - Phe 152 (Accession # P08700-1). |
Filter by Rating