Human IL3 protein

• Catalog Number: orb594807
• Category: Proteins
• Description: Recombinant Human Interleukin-3(IL3) (Active)
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Protein Length: Full Length of Mature Protein
• UniProt ID: P08700
• MW: 16.6 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89uM as determined in BLI assay. ②Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay.
• Expression Region: 20-152aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Interleukin-3; IL-3; Hematopoietic Growth Factor;
• Research Area: Immunology & Inflammation
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.