You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL3 protein (Active)
Catalog Number: orb358969
| Catalog Number | orb358969 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL3 active protein |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P08700 |
| MW | 15.0 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of ＞ 1.0 × 107 IU/mg. |
| Expression Region | 20-152aa(P27S) |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | IL-3, Mast cell growth factor, MCGF, Multipotentia Read more... |
| Note | For research use only |
- Item 1 of 1
Human IL3 protein [orb594806]
Greater than 95% as determined by SDS-PAGE.
16.1 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL3 protein [orb594807]
Greater than 95% as determined by SDS-PAGE.
16.6 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Recombinant human IL-3 protein (Active, HEK293) [orb1817175]
> 95% as determined by SDS-PAGE
25-40 kDa
50 μg, 10 μg, 500 μg 
Recombinant Human Interleukin-3 protein(IL3) (Active) [orb1650644]
100 μg, 1 mg, 10 μg, 250 μg, 500 μg
