Human EBI3 Protein

SKU: orb425206

Description

Recombinant of human EBI3 protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Escherichia Coli
• Biological Activity: Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
• Protein Sequence: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
• Purity: Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
• Disclaimer: For research use only

Alternative Names

Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.