IGF2BP2 Rabbit Polyclonal Antibody

• Catalog Number: orb330141
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGF2BP2
• Target: IGF2BP2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2
• Protein Sequence: Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
• UniProt ID: Q9Y6M1
• MW: 66kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Anti-A170 antibody, anti-EBI 3 associated protein
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_006539

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, IGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080.