You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330141 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IGF2BP2 |
Target | IGF2BP2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2 |
Protein Sequence | Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS |
UniProt ID | Q9Y6M1 |
MW | 66kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Anti-A170 antibody, anti-EBI 3 associated protein Read more... |
Note | For research use only |
NCBI | NP_006539 |
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, IGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080.
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |