You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CNTF protein
Catalog Number: orb603982
| Catalog Number | orb603982 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Ciliary neurotrophic factor(CNTF),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN |
| Protein Length | Partial |
| UniProt ID | P26441 |
| MW | 26.1 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 4-196aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Ciliary neurotrophic factor, CNTF, CNTF_HUMAN, HCN Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human CNTF protein (Active) [orb359177]
> 97% as determined by SDS-PAGE and HPLC.
22.9 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Human CNTF protein [orb594966]
Greater than 85% as determined by SDS-PAGE.
26.8 kDa
Baculovirus
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CNTF protein [orb603981]
Greater than 85% as determined by SDS-PAGE.
27.0 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CNTF Protein [orb1471705]
Greater than 95% as determined by reducing SDS-PAGE.
22.93 KDa
Mammalian
50 μg, 10 μg 
Human CNTF protein [orb391500]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μg
