You have no items in your shopping cart.
Human CNTF protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 x 10 ^ 3 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 22.9 kDa |
| Expression Region | 1-200aa |
| Protein Length | Full Length |
| Protein Sequence | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantCT-1,Human [orb1494756]
> 95% as analyzed by SDS-PAGE.
24~26kDa, observed by reducing SDS-PAGE.
CHO
10 μg, 50 μgRecombinant human CNTF protein (Active, E.coli) [orb2978608]
≥ 95% as determined by SDS-PAGE.
22.9 kDa
10 μg, 500 μg, 50 μgRecombinant Human Ciliary neurotrophic factor protein(CNTF) (Active) [orb1650777]
>97% as determined by SDS-PAGE and HPLC.
22.9 kDa
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μgHuman CNTF (His Active) Protein [orb424831]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SDS-PAGE analysis of Human CNTF protein (Active)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CNTF protein (Active) (orb359177)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review