You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594966 |
---|---|
Category | Proteins |
Description | Recombinant Human Ciliary neurotrophic factor(CNTF) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Protein Length | Full Length of Mature Protein |
UniProt ID | P26441 |
MW | 26.8 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Not test. |
Source | Baculovirus |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-200aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | CNTF |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
22.9 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
26.1 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
27.0 kDa | |
E.coli |
Greater than 95% as determined by reducing SDS-PAGE. | |
22.93 KDa | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |