Human CD40 protein

• Catalog Number: orb594872
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial (Active)
• Tag: C-terminal Fc-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
• Protein Length: Extracellular Domain
• UniProt ID: P25942
• MW: 46.3 kDa
• Application notes: Extracellular Domain
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD40L-His-Flag at 10μg/ml can bind Human CD40-Fc, the ED50 of Human CD40-Fc is 0.45 ug/ml.
• Expression Region: 21-193aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Tumor Necrosis Factor Receptor Superfamily member
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.