Human BCL2 protein

SKU: orb603931

Description

This Human BCL2 protein spans the amino acid sequence from region 2-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: C-terminal 10xHis-tagged
• Expression Region: 2-211aa
• Protein Length: Partial
• MW: 25.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Apoptosis regulator Bcl 2, Apoptosis regulator Bcl-2, Apoptosis regulator Bcl2, AW986256, B cell CLL/lymphoma 2, B cell leukemia/lymphoma 2, Bcl-2, Bcl2, BCL2_HUMAN, C430015F12Rik, D630044D05Rik, D830018M01Rik, Leukemia/lymphoma, B-cell, 2, Oncogene B-cell leukemia 2, PPP1R50, Protein phosphatase 1 regulatory subunit 50, Protein phosphatase 1, regulatory subunit 50

Quick Database Links

UniProt

P10415