You have no items in your shopping cart.
Cart summary
Human ALPI Protein
Catalog Number: orb1477845
| Catalog Number | orb1477845 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Intestinal-type alkaline phosphatase(ALPI) (Active) |
| Tag | N-terminal 10xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 55.2 kDa |
| UniProt ID | P09923 |
| Protein Sequence | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Expression System | Expression Region: 20-503aa. Protein Length: Full Length of Mature Protein |
| Biological Activity | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate (pNPP), in 1 minute at 37°C, pH10.0. The specific activity is > 8836.463 U/mg. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (IAP)(Intestinal alkaline phosphatase) Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human ALPI protein [orb704893]
Greater than 85% as determined by SDS-PAGE.
58.4 kDa
E.coli
20 μg, 100 μg, 1 mgHuman ALPI protein [orb245736]
Greater than 90% as determined by SDS-PAGE.
54.4 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman ALPI protein [orb245527]
Greater than 90% as determined by SDS-PAGE.
55.5 kDa
E.coli
20 μg, 100 μg, 1 mgHuman ALPP Protein, His Tag [orb1743334]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.5 kDa after removal of the signal peptide. The apparent molecular mass of ALPP-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgRecombinant Human ALPP Protein, His Tag [orb1552938]
≥90% as determined by SDS-PAGE
This protein contains the human ALPP(Ile23-Asp506) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars