ALPP Rabbit Polyclonal Antibody

• Catalog Number: orb578290
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALPP
• Target: ALPP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALPP
• Protein Sequence: Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
• UniProt ID: P05187
• MW: 58 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALP, IAP, ALPI, PALP, PLAP, PLAP-1
• Research Area: Disease Biomarkers, Signal Transduction
• Note: For research use only
• NCBI: NP_001623

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Rabbit Anti-ALPP Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ALPP Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.