HIF1a Antibody

SKU: orb334997

Description

Goat polyclonal to alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in apoptosis, angiogenesis, energy metabolism, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in tumour angiogenesis, embryonic vascularization, and pathophysiology of ischemic disease.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli. Antigen Sequence: LNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPY
• Target: Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

alpha subunit (basic helix-loop-helix transcription factor), ARNT interacting protein, basic-helix-loop-helix-PAS protein MOP1, bHLHe78, class E basic helix-loop-helix protein 78, HIF-1alpha, HIF1, HIF1-ALPHA, HIF1a, hypoxia inducible factor 1, hypoxia-inducible factor 1 alpha isoform I.3, hypoxia-inducible factor 1, hypoxia-inducible factor 1-alpha, member of PAS protein 1, member of PAS superfamily 1, MOP1, PASD8, PAS domain-containing protein 8 antibody.

Western blot analysis of staining of HT1080 cells in the presence of CoCl2 lysate using HIF1 alpha antibody

Quick Database Links

Gene Symbol

Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)