Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRN Rabbit Polyclonal Antibody

SKU: orb330767
KO/KD
Validated
KO/KD Validated

Description

GRN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GRN. It is suitable for KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the middle region of Human GRN. This antibody reacts with Human samples and is predicted to react with Equine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsKO/KD Validated, WB
ReactivityHuman
Predicted ReactivityEquine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human GRN
TargetGRN
Protein SequenceSynthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
Molecular Weight64 kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti GRN antibody, anti antibody

Similar Products

  • GRN Rabbit Polyclonal Antibody [orb330766]

    WB

    Bovine, Canine, Equine, Rabbit

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Granulin Rabbit Polyclonal Antibody [orb11269]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GRN Antibody (C-term) [orb1927391]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GRN Rabbit Polyclonal Antibody [orb395097]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GRN Rabbit Polyclonal Antibody [orb395098]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRN Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 52 kDa is also present in some samples.

GRN Rabbit Polyclonal Antibody

50 ug of HEK293T WT and GRN KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/5000. The second image shows Ponceau S staining of the transferred blot as a loading control experiment.

GRN Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

GRN Rabbit Polyclonal Antibody

Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

GRN Rabbit Polyclonal Antibody

Immunoprecipitation was performed on concentrated culture media from Brefeldin A treated HEK293T cells using 1.0 μg of the antibody pre-coupled to either protein G or protein A magnetic beads. Samples were washed and processed for immunoblot with an alternate GRN antibody at 1/1000. The Ponceau stained transfers of each blot are shown. SM=10% starting material; UB=10% unbound fraction; IP=immunoprecipitate.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GRN Rabbit Polyclonal Antibody (orb330767)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry