Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRN Rabbit Polyclonal Antibody

SKU: orb330766

Description

GRN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GRN. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human GRN. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human GRN
TargetGRN
Protein SequenceSynthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD
Molecular Weight47 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CLN11 antibody, anti GEP antibody, anti GP88 antibody, anti PCDGF antibody, anti PEPI antibody, anti PGRN antibody

Similar Products

  • GRN Rabbit Polyclonal Antibody [orb330767]

    KO/KD Validated,  WB

    Equine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Granulin Rabbit Polyclonal Antibody [orb11269]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GRN Antibody (C-term) [orb1927391]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GRN Rabbit Polyclonal Antibody [orb395097]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GRN Rabbit Polyclonal Antibody [orb395098]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRN Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 47 kDa, and a third isoform of 44 kDa are also present in some samples.

GRN Rabbit Polyclonal Antibody

Sample Type: Thyroid Tumor lysates, Antibody dilution: 1.0 ug/ml.

GRN Rabbit Polyclonal Antibody

Positive control (+): Human Lymph Node (LN), Negative control (-): Human Pancreas (PA), Antibody concentration: 1 ug/ml.

GRN Rabbit Polyclonal Antibody

Rabbit Anti-GRN Antibody, Catalog Number: orb330766, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002078

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GRN Rabbit Polyclonal Antibody (orb330766)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry