GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb Antibody

SKU: orb3166836

Description

Our chicken Anti-GluA2/GluR2 glutamate receptor recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, IP, ELISA, EM.

Images & Validation

• Tested Applications: ELISA, EM, ICC, IHC, IP, WB
• Dilution Range: WB: 1:500-1:1000; WB Brain: 1:500-1:1000; IHC: 1:250-1:500; ICC: 1:500
• Reactivity: Human, Mouse, Rat

Key Properties

• Antibody Type: Recombinant Antibody
• Host: Gallus
• Clonality: Recombinant
• Isotype: IgY
• Clone No.: L21/32
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Target: GluA2/GluR2 glutamate receptor
• Molecular Weight: 90 kDa
• Purification: Purified by affinity chromatography
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Liquid
• Buffer/Preservatives: 1X PBS, 0.05% Sodium Azide pH 7.4
• Concentration: 1 mg/mL
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Quick Database Links

Gene Symbol

GluA2/GluR2 glutamate receptor

UniProt

P19491