Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free) Antibody

SKU: orb3166831

Description

Our chicken Anti-GluA2/GluR2 glutamate receptor carrier-free recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, ELISA.

Images & Validation

Tested ApplicationsELISA, EM, ICC, IHC, IP, WB
Dilution RangeWB: 1:500-1:1000; WB Brain: 1:500-1:1000; IHC: 1:250-1:500; ICC: 1:500
ReactivityHuman, Mouse, Rat

Key Properties

Antibody TypeRecombinant Antibody
HostGallus
ClonalityRecombinant
IsotypeIgY
Clone No.L21/32
ImmunogenFusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
TargetGluA2/GluR2 glutamate receptor
Molecular Weight90 kDa
PurificationPurified by affinity chromatography
ConjugationCarrier-free

Storage & Handling

StorageAliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Form/AppearanceLiquid
Buffer/PreservativesPBS
Concentration1 mg/mL
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
ICC
Immunocytochemistry
View Protocol
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol
IP
Immunoprecipitation
View Protocol
EM
Electron Microscopy
View Protocol

GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free) Antibody (orb3166831)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 1,020.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 5-10 working days
Bulk Enquiry