Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

GLP-1 (1-36) amide

SKU: orb1140536

Description

Proglucagon (72-107) proteolysis product; Peptides.

Research Area

Metabolism Research

Images & Validation

Key Properties

CAS Number99658-04-5
MW4111.5 Da
Purity> 95% by HPLC
FormulaC184H273N51O57
Protein SequenceH-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Storage & Handling

StorageStore desiccated, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

99658-04-5GH030, GLP-1 (1-36) amide, H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, posttranslational, proglucagon (72-107)

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry