Glucagon - Like Peptide 1, (GLP - 1) amide, human

SKU: orb2694509

Description

GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.

Research Area

Pharmacology & Drug Discovery

Images & Validation

−

Key Properties

−

Target	GLP Receptor GCGR
CAS Number	99658-04-5
MW	4111.53
Purity	≥95%
Formula	C₁₈₄H₂₇₃N₅₁O₅₇
Protein Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

GLP Receptor GCGR

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols