Glucagon - Like Peptide 1, (GLP - 1) amide, human

• Catalog Number: orb2694509
• Category: Proteins
• Description: GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.
• CAS Number: 99658-04-5
• Purity: ≥95%
• MW: 4111.53
• Formula: C₁₈₄H₂₇₃N₅₁O₅₇
• Target: GLP Receptor GCGR
• Protein Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
• Note: For research use only
• Expiration Date: 6 months from date of receipt.