[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

• Catalog Number: orb2694351
• Category: Proteins
• Description: (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.
• CAS Number: 215777-46-1
• Purity: ≥95%
• MW: 3313.7
• Formula: C₁₄₉H₂₂₆N₄₀O₄₆
• Target: GCCR
• Protein Sequence: HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
• Note: For research use only
• Expiration Date: 6 months from date of receipt.