You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579093 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to G6pc |
Target | G6pc |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
UniProt ID | P35576 |
MW | 40kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | G6P, G6pt, G6pc1, G6Pase, Glc-6-, AW107337, Glc-6- Read more... |
Note | For research use only |
NCBI | NP_032087 |
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Lung, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-G6pc Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Intestine.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |