G6pc Rabbit Polyclonal Antibody

• Catalog Number: orb579093
• Category: Antibodies
• Description: Rabbit polyclonal antibody to G6pc
• Target: G6pc
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
• UniProt ID: P35576
• MW: 40kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: G6P, G6pt, G6pc1, G6Pase, Glc-6-, AW107337, Glc-6-
• Note: For research use only
• NCBI: NP_032087

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Lung, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-G6pc Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Intestine.