You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579094 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to G6PC |
Target | G6PC |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC |
Protein Sequence | Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
UniProt ID | P35575 |
MW | 40 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | G6PC, G6PT, GSD1, GSD1a, G6Pase |
Note | For research use only |
NCBI | NP_000142 |
Immunohistochemistry with Human kidney lysate tissue.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is glycosylated.
Formalin Fixed Paraffin Embedded Tissue: Normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.
Formalin Fixed Paraffin Embedded Tissue: Normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.
Sample Tissue: Human HL-60 Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Human kidney (KI), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.
WB Suggested Anti-G6PC Antibody Titration: 1 ug/ml, Positive Control: Fetal Lung cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |