Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

G6PC Rabbit Polyclonal Antibody

SKU: orb579094

Description

G6PC Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of G6PC. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
TargetG6PC
Protein SequenceSynthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Molecular Weight40 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G6PC, G6PT, GSD1, GSD1a, G6Pase

Similar Products

  • G6PC Rabbit Polyclonal Antibody [orb6097]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • G6PC Antibody (Center) [orb1930612]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • G6pc Rabbit Polyclonal Antibody [orb579093]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • G6PC Rabbit Polyclonal Antibody [orb608025]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Human, Porcine, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • G6PC1 Rabbit Polyclonal Antibody [orb1473608]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

G6PC Rabbit Polyclonal Antibody

Immunohistochemistry with Human kidney lysate tissue.

G6PC Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is glycosylated.

G6PC Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: Normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

G6PC Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: Normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

G6PC Rabbit Polyclonal Antibody

Sample Tissue: Human HL-60 Cell, Antibody Dilution: 1 ug/ml.

G6PC Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

G6PC Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

G6PC Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

G6PC Rabbit Polyclonal Antibody

Positive control (+): Human kidney (KI), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

G6PC Rabbit Polyclonal Antibody

WB Suggested Anti-G6PC Antibody Titration: 1 ug/ml, Positive Control: Fetal Lung cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000142

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

G6PC Rabbit Polyclonal Antibody (orb579094)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry