FGFR2 Rabbit Polyclonal Antibody

• Catalog Number: orb584555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FGFR2
• Target: FGFR2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FGFR2
• Protein Sequence: Synthetic peptide located within the following region: KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ
• UniProt ID: P21802
• MW: 78kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BEK, JWS, BBDS, CEK3, CFD1, ECT1, KGFR, TK14, TK25
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_075259

Sample Type: HEK293 (20 ug), Primary dilution: 1:200, Secondary dilution: 1:5000.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-FGFR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. FGFR2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.