ERBB1 Antibody

SKU: orb379726

Description

Goat polyclonal antibody to ERBB1. ERBB1 is a transmembrane glycoprotein that is a member of the protein kinase superfamily and a receptor for members of the epidermal growth factor family. It is a cell surface protein that binds to epidermal growth factor inducing receptor dimerization and tyrosine autophosphorylation and leading to cell proliferation. This receptor has been associated with cancer. Different protein isoforms encoded by multiple alternatively spliced transcript variants have been found for this gene.

Images & Validation

• Tested Applications: IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.. Antigen Sequence: SHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
• Target: Epidermal growth factor receptor
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

EGFR, epidermal growth factor receptor, ERBB, HER1, mENA, NISBD2PIG61, antibody.

Western blot analysis of human recombinant protein using ERBB1 antibody

Quick Database Links

Gene Symbol

Epidermal growth factor receptor