ERBB1 Antibody

• Catalog Number: orb379726
• Category: Antibodies
• Description: Goat polyclonal antibody to ERBB1. ERBB1 is a transmembrane glycoprotein that is a member of the protein kinase superfamily and a receptor for members of the epidermal growth factor family. It is a cell surface protein that binds to epidermal growth factor inducing receptor dimerization and tyrosine autophosphorylation and leading to cell proliferation. This receptor has been associated with cancer. Different protein isoforms encoded by multiple alternatively spliced transcript variants have been found for this gene.
• Target: Epidermal growth factor receptor
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.. Antigen Sequence: SHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
• Tested applications: IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EGFR, epidermal growth factor receptor, ERBB, HER1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human recombinant protein using ERBB1 antibody