Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ERBB1 Antibody

SKU: orb379726

Description

Goat polyclonal antibody to ERBB1. ERBB1 is a transmembrane glycoprotein that is a member of the protein kinase superfamily and a receptor for members of the epidermal growth factor family. It is a cell surface protein that binds to epidermal growth factor inducing receptor dimerization and tyrosine autophosphorylation and leading to cell proliferation. This receptor has been associated with cancer. Different protein isoforms encoded by multiple alternatively spliced transcript variants have been found for this gene.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC-Fr, IHC-P, WB
Dilution RangeWB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. Antigen Sequence: SHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
TargetEpidermal growth factor receptor
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EGFR, epidermal growth factor receptor, ERBB, HER1, mENA, NISBD2PIG61, antibody.

Similar Products

  • Amivantamab Biosimilar Antibody, Research Grade (EGFR/c-Met) [orb2977888]

    ELISA,  FA,  FACS,  In vivo

    Human

    Human

    Monoclonal

    Unconjugated

    100 μg, 1 mg
  • H3K18ac Antibody [orb1256501]

    ChIP,  IF,  IHC,  IP,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • EGFR Rabbit Polyclonal Antibody [orb10580]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • H3R26me2s Antibody [orb1257936]

    IF,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • EGFR Rabbit Polyclonal Antibody [orb654422]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ERBB1 Antibody

Western blot analysis of human recombinant protein using ERBB1 antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IHC-Fr
Immunohistochemistry Frozen
View Protocol

ERBB1 Antibody (orb379726)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 300.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry