Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CTNNB1 Rabbit Polyclonal Antibody

SKU: orb592829

Description

CTNNB1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CTNNB1. It is suitable for ChIP, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsChIP, WB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1
TargetCTNNB1
Protein SequenceSynthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
Molecular Weight86 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EVR7, CTNNB, MRD19, NEDSDV, armadillo

Similar Products

  • CTNNB1 Rabbit Polyclonal Antibody [orb592819]

    IHC-P,  WB

    Canine, Equine, Guinea pig, Rabbit, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Beta catenin Rabbit Polyclonal Antibody [orb500798]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • beta Catenin/CTNNB1 Rabbit Polyclonal Antibody [orb402308]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Beta catenin Rabbit Polyclonal Antibody [orb10246]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CTNNB1 Antibody (C-term) [orb1927592]

    FC,  IF,  IHC-P,  WB

    Mouse, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CTNNB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CTNNB1 Rabbit Polyclonal Antibody

CTNNB1 antibody - middle region (orb592829) validated by CHIP using HCT116 cell lysate.

CTNNB1 Rabbit Polyclonal Antibody

CTNNB1 antibody - middle region (orb592829) validated by CHIP using HCT116 cell lysate.

CTNNB1 Rabbit Polyclonal Antibody

CTNNB1 antibody - middle region (orb592829) validated by WB using HCT116 cell lysate. CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116.

CTNNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-CTNNB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Fetal Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001895

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

CTNNB1 Rabbit Polyclonal Antibody (orb592829)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry