Cart summary

You have no items in your shopping cart.

CTNNB1 Rabbit Polyclonal Antibody

Catalog Number: orb592819

Select Product Size
SizePriceQuantity
100 μl$ 540.00
100 μl Enquire
DispatchUsually dispatched within 3-7 working days
Product Properties
Catalog Numberorb592819
CategoryAntibodies
DescriptionRabbit polyclonal antibody to CTNNB1
TargetCTNNB1
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse
Predicted ReactivityCanine, Equine, Guinea pig, Rabbit, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationProtein A purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
Protein SequenceSynthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
MW86 kDa
Tested applicationsIHC-P, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesEVR7, CTNNB, MRD19, NEDSDV, armadillo
Research AreaCancer Biology, Cell Biology, Epigenetics & Chroma
Read more...
NoteFor research use only
NCBIXP_001133664
Images
CTNNB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CTNNB1 Rabbit Polyclonal Antibody

CTNNB1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb592819 with 1:200 dilution. Western blot was performed using orb592819 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: CTNNB1 IP with orb592819 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Human Intestine

CTNNB1 Rabbit Polyclonal Antibody

Rabbit Anti-CTNNB1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

CTNNB1 Rabbit Polyclonal Antibody

Rabbit Anti-CTNNB1 Antibody, Catalog Number: orb592819, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CTNNB1 Rabbit Polyclonal Antibody

Sample Type: HCT116 cell lysate. CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116.

CTNNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-CTNNB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Similar Products
  • Beta catenin Rabbit Polyclonal Antibody [orb500798]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Beta catenin Rabbit Polyclonal Antibody [orb10246]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-beta Catenin (Tyr333) Rabbit Polyclonal Antibody [orb155828]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Beta-Catenin (Ser33 + Ser37) Rabbit Polyclonal Antibody [orb5768]

    FC,  IF,  IHC-Fr,  IHC-P

    Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CTNNB1 Rabbit Polyclonal Antibody [orb592829]

    ChIP,  WB

    Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Reviews

CTNNB1 Rabbit Polyclonal Antibody (orb592819)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet