Cart summary

You have no items in your shopping cart.

CTNNB1 Rabbit Polyclonal Antibody

SKU: orb592819

Description

Rabbit polyclonal antibody to CTNNB1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman, Mouse
Predicted ReactivityCanine, Equine, Guinea pig, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
TargetCTNNB1
Protein SequenceSynthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Molecular Weight86 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EVR7, CTNNB, MRD19, NEDSDV, armadillo

Similar Products

  • Beta catenin Rabbit Polyclonal Antibody [orb500798]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • beta Catenin/CTNNB1 Rabbit Polyclonal Antibody [orb402308]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Beta catenin Rabbit Polyclonal Antibody [orb10246]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-beta Catenin (Tyr333) Rabbit Polyclonal Antibody [orb155828]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Beta-Catenin (Ser33 + Ser37) Rabbit Polyclonal Antibody [orb5768]

    FC,  IF,  IHC-Fr,  IHC-P

    Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CTNNB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CTNNB1 Rabbit Polyclonal Antibody

CTNNB1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb592819 with 1:200 dilution. Western blot was performed using orb592819 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: CTNNB1 IP with orb592819 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

CTNNB1 Rabbit Polyclonal Antibody

Human Intestine

CTNNB1 Rabbit Polyclonal Antibody

Rabbit Anti-CTNNB1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

CTNNB1 Rabbit Polyclonal Antibody

Rabbit Anti-CTNNB1 Antibody, Catalog Number: orb592819, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CTNNB1 Rabbit Polyclonal Antibody

Sample Type: HCT116 cell lysate. CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116.

CTNNB1 Rabbit Polyclonal Antibody

WB Suggested Anti-CTNNB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

CTNNB1 Rabbit Polyclonal Antibody (orb592819)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry