You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592819 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CTNNB1 |
Target | CTNNB1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Canine, Equine, Guinea pig, Rabbit, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1 |
Protein Sequence | Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL |
MW | 86 kDa |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EVR7, CTNNB, MRD19, NEDSDV, armadillo |
Note | For research use only |
NCBI | XP_001133664 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
CTNNB1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb592819 with 1:200 dilution. Western blot was performed using orb592819 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: CTNNB1 IP with orb592819 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Human Intestine
Rabbit Anti-CTNNB1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-CTNNB1 Antibody, Catalog Number: orb592819, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: HCT116 cell lysate. CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116.
WB Suggested Anti-CTNNB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Gallus, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |