CISH Rabbit Polyclonal Antibody

• Catalog Number: orb589623
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CISH
• Target: CISH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CISH
• Protein Sequence: Synthetic peptide located within the following region: RILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALP
• UniProt ID: Q9NSE2
• MW: 30 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CIS, G18, SOCS, CIS-1, BACTS2
• Note: For research use only
• NCBI: NP_037456.5
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml.