Cish Rabbit Polyclonal Antibody

• Catalog Number: orb581837
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cish
• Target: Cish
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT
• UniProt ID: Q62225
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C, CI, Cis, F17, F23, CIS1, SOCS, CIS-1
• Research Area: Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_034025
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Mouse Kidney, Antibody dilution: 1 ug/ml.

WB Suggested Anti-Cish Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.