CD31 Antibody

SKU: orb334956

Description

Goat polyclonal antibody to CD31. CD31 is a 130-140 kDa type I transmembrane glycoprotein. It is expressed in platelets, granulocytes, stem cells of myeloid lineage, monocytes and endothelial cells. It is likely to be involved in integrin activation, leukocyte migration and angiogenesis.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Human, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. Antigen Sequence: TEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
• Target: Platelet/endothelial Cell Adhesion Molecule (PECAM1)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD31/endoCAM, endoCAM, PECA1, PECAM1, PECAM-1, platelet/endothelial adhesion molecule 1 antibody.

Quick Database Links

Gene Symbol

Platelet/endothelial Cell Adhesion Molecule (PECAM1)